PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20118-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 148aa    MW: 17004.3 Da    PI: 10.6406
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20118-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35.3e-1153101755
                      HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +rr   NR +A+rsR RK+ +i eLe+ v +L++e +aL  ++ +l  +
  TRIUR3_20118-P1  53 TRRILANRQSAQRSRVRKLHYISELERSVTSLQTEVSALSPRVASLDHQ 101
                      588899*********************************9999888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.8E-852111IPR004827Basic-leucine zipper domain
PfamPF001704.5E-1053103IPR004827Basic-leucine zipper domain
CDDcd147035.68E-1754102No hitNo description
PROSITE profilePS502178.96754105IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-1054105No hitNo description
PROSITE patternPS0003605469IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-1354105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
VAGAHEFDRL DDDQLMSMFS DELAPQRQAQ AATPPRSRQC TAPRGRILQF LYTRRILANR  60
QSAQRSRVRK LHYISELERS VTSLQTEVSA LSPRVASLDH QRSLLTLGNS HLKQRIAALA  120
QDKIFKDAHQ EALKKEIERL SQIYQQQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0368211e-112BT036821.1 Zea mays full-length cDNA clone ZM_BFb0141B19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694867.12e-62PREDICTED: basic leucine zipper 2-like
SwissprotQ6K3R94e-59BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLT1MQF31e-103T1MQF3_TRIUA; Uncharacterized protein
STRINGMLOC_72368.48e-63(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.14e-49bZIP family protein